PDB entry 1mzs

View 1mzs on RCSB PDB site
Description: CRYSTAL STRUCTURE OF BETA-KETOACYL-ACP SYNTHASE III WITH BOUND dichlorobenzyloxy-indole-carboxylic acid inhibitor
Class: transferase
Keywords: fabh, transferase
Deposited on 2002-10-09, released 2002-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase III
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R0 (0-316)
      • modified residue (111)
    Domains in SCOPe 2.06: d1mzsa1, d1mzsa2
  • Heterogens: PO4, 669, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzsA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf