PDB entry 1mzr

View 1mzr on RCSB PDB site
Description: Structure of dkga from E.coli at 2.13 A resolution solved by molecular replacement
Class: oxidoreductase
Keywords: alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, Bacterial targets at IGS-CNRS, France, BIGS, Structural Genomics, OXIDOREDUCTASE
Deposited on 2002-10-09, released 2003-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.175
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,5-diketo-D-gluconate reductase A
    Species: Escherichia coli [TaxId:562]
    Gene: yqhe
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mzra_
  • Chain 'B':
    Compound: 2,5-diketo-D-gluconate reductase A
    Species: Escherichia coli [TaxId:562]
    Gene: yqhe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46857 (22-295)
      • cloning artifact (20-21)
    Domains in SCOPe 2.08: d1mzrb1, d1mzrb2
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mzrA (A:)
    msyyhhhhhhlestslykkaglanptviklqdgnvmpqlglgvwqasneevitaiqkale
    vgyrsidtaaaykneegvgkalknasvnreelfittklwnddhkrprealldslkklqld
    yidlylmhwpvpaidhyveawkgmielqkegliksigvcnfqihhlqrlidetgvtpvin
    qielhplmqqrqlhawnathkiqteswsplaqggkgvfdqkvirdladkygktpaqivir
    whldsglvvipksvtpsriaenfdvwdfrldkdelgeiakldqgkrlgpdpdqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzrA (A:)
    anptviklqdgnvmpqlglgvwqasneevitaiqkalevgyrsidtaaaykneegvgkal
    knasvnreelfittklwnddhkrprealldslkklqldyidlylmhwpvpaidhyveawk
    gmielqkegliksigvcnfqihhlqrlidetgvtpvinqielhplmqqrqlhawnathki
    qteswsplaqggkgvfdqkvirdladkygktpaqivirwhldsglvvipksvtpsriaen
    fdvwdfrldkdelgeiakldqgkrlgpdpdqfgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mzrB (B:)
    msyyhhhhhhlestslykkaglanptviklqdgnvmpqlglgvwqasneevitaiqkale
    vgyrsidtaaaykneegvgkalknasvnreelfittklwnddhkrprealldslkklqld
    yidlylmhwpvpaidhyveawkgmielqkegliksigvcnfqihhlqrlidetgvtpvin
    qielhplmqqrqlhawnathkiqteswsplaqggkgvfdqkvirdladkygktpaqivir
    whldsglvvipksvtpsriaenfdvwdfrldkdelgeiakldqgkrlgpdpdqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzrB (B:)
    glanptviklqdgnvmpqlglgvwqasneevitaiqkalevgyrsidtaaaykneegvgk
    alknasvnreelfittklwnddhkrprealldslkklqldyidlylmhwpvpaidhyvea
    wkgmielqkegliksigvcnfqihhlqrlidetgvtpvinqielhplmqqrqlhawnath
    kiqteswsplaqggkgvfdqkvirdladkygktpaqivirwhldsglvvipksvtpsria
    enfdvwdfrldkdelgeiakldqgkrlgpdpdqfgg