PDB entry 1mzm

View 1mzm on RCSB PDB site
Description: maize nonspecific lipid transfer protein complexed with palmitate
Class: lipid transport
Keywords: alpha-helical structure, lipid transport
Deposited on 1995-01-26, released 1996-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: maize nonspecific lipid transfer protein
  Species: Zea mays [TaxId:4577]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19656 (0-92)
  Domains in SCOPe 2.08: d1mzma_
• Heterogens: PLM, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mzmA (A:)
  aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
  sglnagnaasipskcgvsipytiststdcsrvn