PDB entry 1mzj

View 1mzj on RCSB PDB site
Description: Crystal Structure of the Priming beta-Ketosynthase from the R1128 Polyketide Biosynthetic Pathway
Class: transferase
Keywords: beta-Ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, TRANSFERASE
Deposited on 2002-10-08, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-ketoacylsynthase III
    Species: Streptomyces sp. R1128 [TaxId:140437]
    Gene: zhuH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mzja1, d1mzja2
  • Chain 'B':
    Compound: Beta-ketoacylsynthase III
    Species: Streptomyces sp. R1128 [TaxId:140437]
    Gene: zhuH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mzjb1, d1mzjb2
  • Heterogens: COA, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mzjA (A:)
    mpglrvperrfsrvlgvgsyrprrevsnkevctwidsteewietrtgirsrriaepdeti
    qvmgvaasrralehagvdpaeidlvvvstmtnfvhtpplsvaiahelgadnaggfdlsaa
    cagfchalsiaadavesggsrhvlvvatermtdvidladrslsflfgdgagaavvgpsdv
    pgigpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaarea
    levagltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldr
    lvrsgavpgggpalmigfgaglsyagqalllpdppstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzjA (A:)
    glrvperrfsrvlgvgsyrprrevsnkevctwidsteewietrtgirsrriaepdetiqv
    mgvaasrralehagvdpaeidlvvvstmtnfvhtpplsvaiahelgadnaggfdlsaaca
    gfchalsiaadavesggsrhvlvvatermtdvidladrslsflfgdgagaavvgpsdvpg
    igpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaareale
    vagltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldrlv
    rsgavpgggpalmigfgaglsyagqalllpdpps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mzjB (B:)
    mpglrvperrfsrvlgvgsyrprrevsnkevctwidsteewietrtgirsrriaepdeti
    qvmgvaasrralehagvdpaeidlvvvstmtnfvhtpplsvaiahelgadnaggfdlsaa
    cagfchalsiaadavesggsrhvlvvatermtdvidladrslsflfgdgagaavvgpsdv
    pgigpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaarea
    levagltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldr
    lvrsgavpgggpalmigfgaglsyagqalllpdppstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzjB (B:)
    pglrvperrfsrvlgvgsyrprrevsnkevctwidsteewietrtgirsrriaepdetiq
    vmgvaasrralehagvdpaeidlvvvstmtnfvhtpplsvaiahelgadnaggfdlsaac
    agfchalsiaadavesggsrhvlvvatermtdvidladrslsflfgdgagaavvgpsdvp
    gigpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaareal
    evagltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldrl
    vrsgavpgggpalmigfgaglsyagqalllpdpp