PDB entry 1mzh

View 1mzh on RCSB PDB site
Description: QR15, an Aldolase
Class: structural genomics, Aldolase
Keywords: alpha-beta barrel, Structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Aldolase
Deposited on 2002-10-07, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66540
      • expression tag (219-224)
    Domains in SCOPe 2.07: d1mzha1, d1mzha2
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66540 (0-218)
      • expression tag (219-220)
    Domains in SCOPe 2.07: d1mzhb1, d1mzhb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzhA (A:)
    midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvi
    gfplglnktsvkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavh
    kvivetpylneeeikkaveicieagadfiktstgfaprgttleevrlikssakgrikvka
    sggirdletaismieagadrigtssgisiaeeflkrhlilehhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mzhB (B:)
    midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvi
    gfplglnktsvkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavh
    kvivetpylneeeikkaveicieagadfiktstgfaprgttleevrlikssakgrikvka
    sggirdletaismieagadrigtssgisiaeeflkrhlilehhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzhB (B:)
    midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvi
    gfplglnktsvkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavh
    kvivetpylneeeikkaveicieagadfiktstgfaprgttleevrlikssakgrikvka
    sggirdletaismieagadrigtssgisiaeeflkrhlile