PDB entry 1mza

View 1mza on RCSB PDB site
Description: crystal structure of human pro-granzyme K
Class: hydrolase
Keywords: granzyme, apoptosis, serine protease, S1 family
Deposited on 2002-10-07, released 2003-01-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.235
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pro-granzyme K
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49863 (0-239)
      • engineered (189)
    Domains in SCOP 1.75: d1mzaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzaA (A:)
    meiiggkevsphsrpfmasiqygghhvcggvlidpqwvltaahcqyrftkgqsptvvlga
    hslskneaskqtleikkfipfsrvtsdpqsndimlvklqtaaklnkhvkmlhirsktslr
    sgtkckvtgwgatdpdslrpsdtlrevtvtvlsrklcnsqsyyngdpfitkdmvcagdak
    gqkdsckgdaggplickgvfhaivsgghecgvatkpgiytlltkkyqtwiksnlvpphtn