PDB entry 1mz9

View 1mz9 on RCSB PDB site
Description: Storage function of COMP:the crystal structure of the coiled-coil domain in complex with vitamin D3
Class: protein binding
Keywords: pentameric coiled-coil domain, PROTEIN BINDING
Deposited on 2002-10-07, released 2003-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.231
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cartilage oligomeric matrix protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R0G6 (1-44)
      • initiating met (0)
    Domains in SCOPe 2.08: d1mz9a_
  • Chain 'B':
    Compound: cartilage oligomeric matrix protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R0G6 (1-44)
      • initiating met (0)
    Domains in SCOPe 2.08: d1mz9b_
  • Chain 'C':
    Compound: cartilage oligomeric matrix protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R0G6 (1-44)
      • initiating met (0)
    Domains in SCOPe 2.08: d1mz9c_
  • Chain 'D':
    Compound: cartilage oligomeric matrix protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R0G6 (1-44)
      • initiating met (0)
    Domains in SCOPe 2.08: d1mz9d_
  • Chain 'E':
    Compound: cartilage oligomeric matrix protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R0G6 (1-44)
      • initiating met (0)
    Domains in SCOPe 2.08: d1mz9e_
  • Heterogens: VDY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mz9A (A:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mz9B (B:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mz9C (C:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mz9D (D:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mz9E (E:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac