PDB entry 1mz8

View 1mz8 on RCSB PDB site
Description: crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion
Class: Toxin,Hydrolase/protein binding
Keywords: H-N-H motif, Toxin, Hydrolase-protein binding COMPLEX
Deposited on 2002-10-07, released 2002-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7 immunity protein
    Species: Escherichia coli [TaxId:562]
    Gene: cei7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mz8a_
  • Chain 'B':
    Compound: colicin e7
    Species: Escherichia coli [TaxId:562]
    Gene: cea7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mz8b_
  • Chain 'C':
    Compound: colicin e7 immunity protein
    Species: Escherichia coli [TaxId:562]
    Gene: cei7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mz8c_
  • Chain 'D':
    Compound: colicin e7
    Species: Escherichia coli [TaxId:562]
    Gene: cea7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mz8d_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mz8A (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mz8B (B:)
    krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
    dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
    pkrhidihrgk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mz8C (C:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mz8D (D:)
    krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
    dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
    pkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mz8D (D:)
    rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
    pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp
    krhidihrgk