PDB entry 1mz5

View 1mz5 on RCSB PDB site
Description: Trypanosoma rangeli sialidase
Class: hydrolase
Keywords: inibitor complex, trypanosomal sialidase, sialyltransferase, hydrolase
Deposited on 2002-10-05, released 2002-10-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli [TaxId:5698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44049 (0-End)
      • conflict (176)
    Domains in SCOPe 2.03: d1mz5a1, d1mz5a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mz5A (A:)
    lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvatadaryetsfd
    nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
    wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefvggv
    gaaivgsngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
    liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
    mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
    tndvyslvfvrfigelqlmksvvrtwkeednhlasictpvvpatppskggcgaavptagl
    vgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfan
    yrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgsw
    elhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptdsr
    vtvtnivlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mz5A (A:)
    lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvatadaryetsfd
    nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
    wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefvggv
    gaaivgsngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
    liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
    mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
    tndvyslvfvrfigelqlmksvvrtwkeednhlasictpvvpagcgaavptaglvgflsh
    sangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfanyrftlv
    atvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgswelhkky
    hvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggpgaptdsrvtvtnivly
    nrrlnsseirtlflsqdmigtd