PDB entry 1myt

View 1myt on RCSB PDB site
Description: crystal structure to 1.74 angstroms resolution of metmyoglobin from yellowfin tuna (thunnus albacares): an example of a myoglobin lacking the d helix
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-05-06, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.74 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Thunnus albacares
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02205 (0-145)
  Domains in SCOP 1.73: d1myta_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mytA (A:)
  adfdavlkcwgpveadyttmgglvltrlfkehpetqklfpkfagiaqadiagnaaisahg
  atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmhekagldagg
  qtalrnvmgiiiadleanykelgfsg