PDB entry 1myo

View 1myo on RCSB PDB site
Description: solution structure of myotrophin, nmr, 44 structures
Class: ank-repeat
Keywords: myotrophin, acetylation, nmr, ank-repeat
Deposited on 1998-08-17, released 1999-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myotrophin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1myoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1myoA (A:)
    mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad
    inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq