PDB entry 1myn

View 1myn on RCSB PDB site
Description: solution structure of drosomycin, the first inducible antifungal protein from insects, nmr, 15 structures
Deposited on 1996-12-26, released 1997-12-31
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-31, with a file datestamp of 1997-12-31.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1myn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1myn_ (-)
    dclsgrykgpcavwdnetcrrvckeegrssghcspslkcwcegc