PDB entry 1myn

View 1myn on RCSB PDB site
Description: solution structure of drosomycin, the first inducible antifungal protein from insects, nmr, 15 structures
Class: signal protein
Keywords: drosomycin, insect immunity, antifungal, csalpha-beta motif, signal protein
Deposited on 1996-12-26, released 1997-12-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: drosomycin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1myna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mynA (A:)
    dclsgrykgpcavwdnetcrrvckeegrssghcspslkcwcegc