PDB entry 1myf

View 1myf on RCSB PDB site
Description: solution structure of carbonmonoxy myoglobin determined from nmr distance and chemical shift constraints
Deposited on 1994-12-02, released 1995-02-27
The last revision prior to the SCOP 1.67 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1myf__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1myf_ (-)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg