PDB entry 1mxs

View 1mxs on RCSB PDB site
Description: Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase from Pseudomonas putida.
Class: lyase
Keywords: 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-barrel, lyase
Deposited on 2002-10-03, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kdpg aldolase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00885 (Start-224)
      • see remark 999 (194)
    Domains in SCOPe 2.07: d1mxsa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mxsA (A:)
    ttlerpqpklsmadkaaridaicekarilpvitiareedilpladalaaggirtlevtlr
    sqhglkaiqvlreqrpelcvgagtvldrsmfaaveaagaqfvvtpgitedileagvdsei
    pllpgistpseimmgyalgyrrfklfpaeisggvaaikafggpfgdirfcptggvnpanv
    rnymalpnvmcvgttwmldsswikngdwarieacsaeaialldan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxsA (A:)
    lsmadkaaridaicekarilpvitiareedilpladalaaggirtlevtlrsqhglkaiq
    vlreqrpelcvgagtvldrsmfaaveaagaqfvvtpgitedileagvdseipllpgistp
    seimmgyalgyrrfklfpaeisggvaaikafggpfgdirfcptggvnpanvrnymalpnv
    mcvgttwmldsswikngdwarieacsaeaialldan