PDB entry 1mxl

View 1mxl on RCSB PDB site
Description: structure of cardiac troponin c-troponin I complex
Class: calcium-binding protein
Keywords: troponin, muscle contraction, regulatory protein, calcium-binding protein
Deposited on 1999-04-22, released 1999-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: protein (troponin c)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mxlc_
  • Chain 'I':
    Compound: protein (troponin I)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mxli_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mxlC (C:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mxlI (I:)
    risadammqallgarak