PDB entry 1mxi

View 1mxi on RCSB PDB site
Description: Structure of YibK from Haemophilus influenzae (HI0766): a Methyltransferase with a Cofactor Bound at a Site Formed by a Knot
Class: transferase
Keywords: methyltransferase, S-adenosylhomocysteine, spoU family, Structure 2 Function Project, S2F, Structural Genomics
Deposited on 2002-10-02, released 2003-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical tRNA/rRNA methyltransferase HI0766
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0766
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mxia_
  • Heterogens: IOD, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1mxiA (A:)
mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrh
ktfeaflesekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqki
ripmtansrsmnlsnsvavtvyeawrqlgykgavnlpevk

    Sequence, based on observed residues (ATOM records): (download) 
    >1mxiA (A:)
mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrh
ktfeaflesekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqki
ripmtansrsmnlsnsvavtvyeawrqlgykgavnl