PDB entry 1mxh

View 1mxh on RCSB PDB site
Description: Crystal Structure of Substrate Complex of Putative Pteridine Reductase 2 (PTR2) from Trypanosoma cruzi
Class: oxidoreductase
Keywords: sdr topology, protein-substrate complex, oxidoreductase
Deposited on 2002-10-02, released 2003-10-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mxha_
  • Chain 'B':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mxhb_
  • Chain 'C':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mxhc_
  • Chain 'D':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mxhd_
  • Heterogens: NAP, DHF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mxhA (A:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxhA (A:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllppidaqvaelfgsnavapl
    flirafarrqsrnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvn
    avapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvd
    gglilara
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mxhB (B:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxhB (B:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllppidaqvaelfgsnavapl
    flirafarrqsrnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvn
    avapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvd
    gglilara
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mxhC (C:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxhC (C:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllppidaqvaelfgsnavapl
    flirafarrqsrnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvn
    avapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvd
    gglilara
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mxhD (D:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxhD (D:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllppidaqvaelfgsnavapl
    flirafarrqsrnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvn
    avapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvd
    gglilara