PDB entry 1mxf

View 1mxf on RCSB PDB site
Description: crystal structure of inhibitor complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi
Deposited on 2002-10-02, released 2003-10-14
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mxfa_
  • Chain 'B':
    Domains in SCOP 1.71: d1mxfb_
  • Chain 'C':
    Domains in SCOP 1.71: d1mxfc_
  • Chain 'D':
    Domains in SCOP 1.71: d1mxfd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mxfA (A:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfA (A:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mxfB (B:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfB (B:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mxfC (C:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfC (C:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mxfD (D:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfD (D:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara