PDB entry 1mxf

View 1mxf on RCSB PDB site
Description: Crystal Structure of Inhibitor Complex of Putative Pteridine Reductase 2 (PTR2) from Trypanosoma cruzi
Class: oxidoreductase
Keywords: sdr topology, protein-inhibitor complex, oxidoreductase
Deposited on 2002-10-02, released 2003-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mxfa_
  • Chain 'B':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mxfb_
  • Chain 'C':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mxfc_
  • Chain 'D':
    Compound: pteridine reductase 2
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: ptr2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mxfd_
  • Heterogens: NDP, MTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mxfA (A:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfA (A:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mxfB (B:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfB (B:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mxfC (C:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfC (C:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mxfD (D:)
    mnetsheasecpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaar
    agsavlckgdlslssslldccediidcsfrafgrcdvlvnnasayyptpllpgddtngaa
    dakpidaqvaelfgsnavaplflirafarrqgeggawrsrnlsvvnlcdamtdlplpgfc
    vytmakhalggltraaalelaprhirvnavapglsllppampqetqeeyrrkvplgqsea
    saaqiadaiaflvskdagyitgttlkvdgglilara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxfD (D:)
    cpaavitggarrighsiavrlhqqgfrvvvhyrhsegaaqrlvaelnaaragsavlckgd
    lslssslldccediidcsfrafgrcdvlvnnasayyptpllpkpidaqvaelfgsnavap
    lflirafarrqnlsvvnlcdamtdlplpgfcvytmakhalggltraaalelaprhirvna
    vapglsllppampqetqeeyrrkvplgqseasaaqiadaiaflvskdagyitgttlkvdg
    glilara