PDB entry 1mxc

View 1mxc on RCSB PDB site
Description: s-adenosylmethionine synthetase with 8-br-adp
Deposited on 1996-01-10, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.187
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1mxc_ (-)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxc_ (-)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdiradpleqgagdqglmfgy
    atnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgidavvl
    stqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcgltgrk
    iivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsyaigva
    eptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghfgrehf
    pwektdkaqllrdaaglk