PDB entry 1mxa

View 1mxa on RCSB PDB site
Description: s-adenosylmethionine synthetase with ppi
Class: transferase
Keywords: transferase, one-carbon metabolism, ATP-binding
Deposited on 1996-01-10, released 1996-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mxaa1, d1mxaa2, d1mxaa3
  • Heterogens: PO4, MG, K, POP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mxaA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxaA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdiradpleqgagdqglmfgy
    atnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgidavvl
    stqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcgltgrk
    iivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsyaigva
    eptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghfgrehf
    pwektdkaqllrdaaglk