PDB entry 1mx8

View 1mx8 on RCSB PDB site
Description: Two homologous rat cellular retinol-binding proteins differ in local structure and flexibility
Class: lipid binding protein
Keywords: beta-barrel, helix-turn-helix, vitamin A, Retonol binding, Transport, lipid binding protein
Deposited on 2002-10-01, released 2003-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinol-binding protein I, holo
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RBP1 or RBP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mx8a_
  • Heterogens: RTL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mx8A (A:)
pvdfngywkmlsnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
aegvtckqvfkkvh