PDB entry 1mx7

View 1mx7 on RCSB PDB site
Description: Two homologous rat cellular retinol-binding proteins differ in local structure and flexibility
Class: lipid binding protein
Keywords: beta-barrel, helix-turn-helix, Vitamin A, retinol-binding, transport, LIPID BINDING PROTEIN
Deposited on 2002-10-01, released 2003-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinol-binding protein I, apo
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RBP1 or RBP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mx7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mx7A (A:)
pvdfngywkmlsnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
aegvtckqvfkkvh