PDB entry 1mx5

View 1mx5 on RCSB PDB site
Description: Crystal Structure of Human Liver Carboxylesterase in complexed with homatropine, a cocaine analogue
Class: hydrolase
Keywords: esterase, hydrolase, cocaine
Deposited on 2002-10-01, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.158
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: liver Carboxylesterase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mx5a_
  • Chain 'B':
    Compound: liver Carboxylesterase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mx5b_
  • Chain 'C':
    Compound: liver Carboxylesterase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mx5c_
  • Chain 'D':
    Compound: liver Carboxylesterase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mx5d_
  • Chain 'E':
    Compound: liver Carboxylesterase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mx5e_
  • Chain 'F':
    Compound: liver Carboxylesterase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mx5f_
  • Heterogens: NAG, NDG, SIA, CL, HTQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mx5A (A:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pqtehiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx5A (A:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mx5B (B:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pqtehiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx5B (B:)
    sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
    syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
    gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
    qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
    kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
    vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
    wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
    ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
    farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mx5C (C:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pqtehiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx5C (C:)
    sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
    syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
    gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
    qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
    kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
    vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
    wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
    ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
    farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mx5D (D:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pqtehiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx5D (D:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mx5E (E:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pqtehiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx5E (E:)
    sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
    syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
    gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
    qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
    kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
    vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
    wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
    ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
    farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mx5F (F:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pqtehiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx5F (F:)
    sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
    syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
    gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
    qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
    kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
    vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
    wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
    ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
    farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak