PDB entry 1mx0

View 1mx0 on RCSB PDB site
Description: Structure of topoisomerase subunit
Class: isomerase
Keywords: GHKL ATPase, topoisomerase, ISOMERASE
Deposited on 2002-10-01, released 2003-01-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (108)
      • modified residue (122)
      • see remark 999 (304)
      • modified residue (410)
      • modified residue (413)
      • see remark 999 (436)
      • modified residue (446)
    Domains in SCOPe 2.08: d1mx0a1, d1mx0a2, d1mx0a3
  • Chain 'B':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (108)
      • modified residue (122)
      • see remark 999 (304)
      • modified residue (410)
      • modified residue (413)
      • see remark 999 (436)
      • modified residue (446)
    Domains in SCOPe 2.08: d1mx0b1, d1mx0b2, d1mx0b3
  • Chain 'C':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (108)
      • modified residue (122)
      • see remark 999 (304)
      • modified residue (410)
      • modified residue (413)
      • see remark 999 (436)
      • modified residue (446)
    Domains in SCOPe 2.08: d1mx0c1, d1mx0c2, d1mx0c3
  • Chain 'D':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (108)
      • modified residue (122)
      • see remark 999 (304)
      • modified residue (410)
      • modified residue (413)
      • see remark 999 (436)
      • modified residue (446)
    Domains in SCOPe 2.08: d1mx0d1, d1mx0d2, d1mx0d3
  • Chain 'E':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (108)
      • modified residue (122)
      • see remark 999 (304)
      • modified residue (410)
      • modified residue (413)
      • see remark 999 (436)
      • modified residue (446)
    Domains in SCOPe 2.08: d1mx0e1, d1mx0e2, d1mx0e3
  • Chain 'F':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (108)
      • modified residue (122)
      • see remark 999 (304)
      • modified residue (410)
      • modified residue (413)
      • see remark 999 (436)
      • modified residue (446)
    Domains in SCOPe 2.08: d1mx0f1, d1mx0f2, d1mx0f3
  • Heterogens: MG, NA, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mx0A (A:)
    gamsakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpniki
    tidliddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavly
    sqmhqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipg
    dwpkaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdr
    eeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlve
    tfkkyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvaf
    ggsipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcst
    kipyksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx0A (A:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvnskriytfklkidinknepiivergsvenfhgtsvaisipgdwpkaksr
    iyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeikilin
    nlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkkyedf
    rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
    epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
    kesiaevediekeiknalmevarklkqylsekrkeqeakkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mx0B (B:)
    gamsakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpniki
    tidliddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavly
    sqmhqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipg
    dwpkaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdr
    eeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlve
    tfkkyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvaf
    ggsipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcst
    kipyksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx0B (B:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
    ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeiki
    linnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkky
    edfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsip
    vgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyk
    sagkesiaevediekeiknalmevarklkqylsek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mx0C (C:)
    gamsakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpniki
    tidliddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavly
    sqmhqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipg
    dwpkaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdr
    eeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlve
    tfkkyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvaf
    ggsipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcst
    kipyksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx0C (C:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
    ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeiki
    linnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkky
    edfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsip
    vgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyk
    sagkesiaevediekeiknalmevarklkqylsekrkeqeakkkll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mx0D (D:)
    gamsakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpniki
    tidliddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavly
    sqmhqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipg
    dwpkaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdr
    eeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlve
    tfkkyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvaf
    ggsipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcst
    kipyksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx0D (D:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
    ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeiki
    linnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkky
    edfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsip
    vgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyk
    sagkesiaevediekeiknalmevarklkqylsekrkeqea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mx0E (E:)
    gamsakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpniki
    tidliddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavly
    sqmhqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipg
    dwpkaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdr
    eeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlve
    tfkkyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvaf
    ggsipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcst
    kipyksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx0E (E:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvnskriytfklkidinknepiivergsventfhgtsvaisipgdwpkaks
    riyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeikili
    nnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkkyed
    frspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvg
    eepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksa
    gkesiaevediekeiknalmevarklkqylsekrke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mx0F (F:)
    gamsakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpniki
    tidliddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavly
    sqmhqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipg
    dwpkaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdr
    eeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlve
    tfkkyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvaf
    ggsipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcst
    kipyksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mx0F (F:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvskriytfklkidinknepiivergsventhgtsvaisipgdwpkaksri
    yeyikrtyiitpyaefifkdpenvtyyprltnkipkppqevkphpygvdreeikilinnl
    krdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkkyedfrs
    psadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvgeep
    ivlryankipliydeksdviwkvveeldwkrygisdqyqmvvmvhlcstkipyksagkes
    iaevediekeiknalmevarklkqylsekrkeqe