PDB entry 1mwz

View 1mwz on RCSB PDB site
Description: Solution structure of the N-terminal domain of ZntA in the Zn(II)-form
Class: hydrolase
Keywords: open-faced beta-sandwich fold, beta-alpha-beta-beta-alpha-beta, HYDROLASE
Deposited on 2002-10-01, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ZntA
    Species: Escherichia coli [TaxId:562]
    Gene: znta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwza_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwzA (A:)
    sgtryswkvsgmdcaacarkvenavrqlagvnqvqvlfateklvvdadndiraqvesalq
    kagyslrdeqaae