PDB entry 1mwy

View 1mwy on RCSB PDB site
Description: Solution structure of the N-terminal domain of ZntA in the apo-form
Class: hydrolase
Keywords: open-faced beta-sandwich fold, beta-alpha-beta-beta-alpha-beta, HYDROLASE
Deposited on 2002-10-01, released 2002-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ZntA
    Species: Escherichia coli [TaxId:562]
    Gene: znta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mwya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mwyA (A:)
sgtryswkvsgmdcaacarkvenavrqlagvnqvqvlfateklvvdadndiraqvesalq
kagyslrdeqaae