PDB entry 1mwy

View 1mwy on RCSB PDB site
Description: solution structure of the n-terminal domain of znta in the apo-form
Deposited on 2002-10-01, released 2002-11-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mwya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwyA (A:)
    sgtryswkvsgmdcaacarkvenavrqlagvnqvqvlfateklvvdadndiraqvesalq
    kagyslrdeqaae