PDB entry 1mww

View 1mww on RCSB PDB site
Description: the structure of the hypothetical protein hi1388.1 from haemophilus influenzae reveals a tautomerase/mif fold
Class: structural genomics, unknown function
Keywords: I1388.1, STRUCTURAL GENOMICS, HYPOTHETICAL PROTEIN, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2002-10-01, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein hi1388.1
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1388.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwwa_
  • Chain 'B':
    Compound: hypothetical protein hi1388.1
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1388.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwwb_
  • Chain 'C':
    Compound: hypothetical protein hi1388.1
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1388.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwwc_
  • Heterogens: CL, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mwwA (A:)
    mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
    vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear
    dldydiyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwwA (A:)
    mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
    vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mwwB (B:)
    mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
    vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear
    dldydiyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwwB (B:)
    mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
    vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mwwC (C:)
    mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
    vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear
    dldydiyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwwC (C:)
    mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
    vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear