PDB entry 1mwp

View 1mwp on RCSB PDB site
Description: n-terminal domain of the amyloid precursor protein
Deposited on 1999-03-09, released 2000-03-15
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1mwpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwpA (A:)
    llaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqitnvve
    anqpvtiqnwckrgrkqckthphfvipyrclvgefv