PDB entry 1mwn

View 1mwn on RCSB PDB site
Description: Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
Class: structural protein
Keywords: S100B, TRTK-12, Calcium-binding, NMR, EF-hand, S100 protein, four helix bundle, helix loop helix, protein-peptide complex, 20 structures, structural protein
Deposited on 2002-09-30, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-100 protein, beta chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwna_
  • Chain 'B':
    Compound: S-100 protein, beta chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwnb_
  • Chain 'X':
    Compound: F-actin capping protein alpha-1 subunit
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: F-actin capping protein alpha-1 subunit
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1mwnA (A:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

    Sequence, based on observed residues (ATOM records): (download) 
    >1mwnA (A:)
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1mwnB (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

    Sequence, based on observed residues (ATOM records): (download) 
    >1mwnB (B:)
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.