PDB entry 1mwn

View 1mwn on RCSB PDB site
Description: solution nmr structure of s100b bound to the high-affinity target peptide trtk-12
Deposited on 2002-09-30, released 2002-12-18
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mwna_
  • Chain 'B':
    Domains in SCOP 1.63: d1mwnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwnA (A:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwnB (B:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dedgdgecdfqefmafvsmvttacheffehe