PDB entry 1mwj

View 1mwj on RCSB PDB site
Description: Crystal Structure of a MUG-DNA pseudo substrate complex
Class: hydrolase/DNA
Keywords: Rossmann Fold, non-hydrolysable DNA-complex, Uracil recognition.
Deposited on 2002-09-30, released 2002-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2002-10-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.19
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G/U mismatch-specific DNA glycosylase
    Species: Escherichia coli
    Gene: MUG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mwja_
  • Chain 'D':
    Compound: 5'-d(*cp*gp*cp*gp*a*gp*(du)p*tp*cp*gp*cp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mwjA (A:)
    mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
    dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
    aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvvrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwjA (A:)
    mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
    dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
    aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv
    

  • Chain 'D':
    No sequence available.