PDB entry 1mwi

View 1mwi on RCSB PDB site
Description: Crystal structure of a MUG-DNA product complex
Class: hydrolase/DNA
Keywords: DNA-glycosylase, nucleotide flipping, abasic site, HYDROLASE-DNA COMPLEX
Deposited on 2002-09-30, released 2002-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G/U mismatch-specific DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene: MUG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mwia_
  • Chain 'D':
    Compound: 5'-d(*cp*gp*cp*gp*ap*gp*(aab)p*tp*cp*gp*cp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1mwiA (A:)
mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvvrgr

    Sequence, based on observed residues (ATOM records): (download) 
    >1mwiA (A:)
mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv

  • Chain 'D':
    No sequence available.