PDB entry 1mwf

View 1mwf on RCSB PDB site
Description: An Immunosuppressive Agent forms A Transition State Analog Complex of IMP Dehydrogenase
Class: oxidoreductase
Keywords: Transition state analogoue, distal flap, general base, drug selectivity, Mizoribine 5'-monophosphate, IMPDH
Deposited on 2002-09-29, released 2003-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-07-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50097 (0-End)
      • see remark 999 (151)
    • Uniprot P50097
    Domains in SCOPe 2.07: d1mwfa1
  • Chain 'B':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50097 (0-End)
      • see remark 999 (151)
    • Uniprot P50097
    Domains in SCOPe 2.07: d1mwfb1
  • Chain 'C':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50097 (0-End)
      • see remark 999 (151)
    • Uniprot P50097
    Domains in SCOPe 2.07: d1mwfc1
  • Chain 'D':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50097 (0-End)
      • see remark 999 (151)
    • Uniprot P50097
    Domains in SCOPe 2.07: d1mwfd1
  • Heterogens: K, MZP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mwfA (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwfA (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mwfB (B:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwfB (B:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mwfC (C:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwfC (C:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mwfD (D:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwfD (D:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk