PDB entry 1mwe

View 1mwe on RCSB PDB site
Description: the x-ray structure of a complex of tern n9 influenza virus neuraminidase complexed with sialic acid at 4 degrees c revealing a second sialic acid binding site
Deposited on 1997-08-27, released 1998-03-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-04, with a file datestamp of 1998-03-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mwe__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwe_ (-)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl