PDB entry 1mwb

View 1mwb on RCSB PDB site
Description: Solution structure of the recombinant hemoglobin from the cyanobacterium Synechocystis sp. PCC 6803 in its hemichrome state
Class: oxygen storage/transport
Keywords: globin, cyanoglobin, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2002-09-27, released 2002-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechocystis sp. [TaxId:1148]
    Gene: slr2097 (glbN)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mwba_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwbA (A:)
    stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
    dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
    lnq