PDB entry 1mwb

View 1mwb on RCSB PDB site
Description: Solution structure of the recombinant hemoglobin from the cyanobacterium Synechocystis sp. PCC 6803 in its hemichrome state
Class: oxygen storage/transport
Keywords: globin, cyanoglobin, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2002-09-27, released 2002-12-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cyanoglobin
  Species: Synechocystis sp. [TaxId:1148]
  Gene: slr2097 (glbN)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73925 (0-122)
  Domains in SCOPe 2.05: d1mwba_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mwbA (A:)
  stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
  dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
  lnq