PDB entry 1mwb

View 1mwb on RCSB PDB site
Description: Solution structure of the recombinant hemoglobin from the cyanobacterium Synechocystis sp. PCC 6803 in its hemichrome state
Deposited on 2002-09-27, released 2002-12-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1mwba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mwbA (A:)
  stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
  dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
  lnq