PDB entry 1mw5

View 1mw5 on RCSB PDB site
Description: structure of hi1480 from haemophilus influenzae
Deposited on 2002-09-27, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mw5a_
  • Chain 'B':
    Domains in SCOP 1.67: d1mw5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mw5A (A:)
    gshmsetdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflk
    faqalpahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldls
    nlpapfyvllpesfaaritllvqdkalpyvrvsmeywhaleykgelndpaankarkeael
    aaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mw5A (A:)
    etdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqal
    pahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpap
    fyvllpesfaaritllvqdkalpyvrvsmeywhaleykgeln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mw5B (B:)
    gshmsetdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflk
    faqalpahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldls
    nlpapfyvllpesfaaritllvqdkalpyvrvsmeywhaleykgelndpaankarkeael
    aaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mw5B (B:)
    etdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqal
    pahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpap
    fyvllpesfaaritllvqdkalpyvrvsmeywhaleykgeln