PDB entry 1mw5

View 1mw5 on RCSB PDB site
Description: Structure of HI1480 from Haemophilus influenzae
Class: structural genomics, unknown function
Keywords: Structural genomics, hypothetical protein, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2002-09-27, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein hi1480
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44209 (Start-158)
      • see remark 999 (10)
      • modified residue (12)
      • see remark 999 (153)
      • cloning artifact (159-166)
    Domains in SCOPe 2.08: d1mw5a1, d1mw5a2
  • Chain 'B':
    Compound: hypothetical protein hi1480
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44209 (Start-158)
      • see remark 999 (10)
      • modified residue (12)
      • see remark 999 (153)
      • cloning artifact (159-166)
    Domains in SCOPe 2.08: d1mw5b1, d1mw5b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mw5A (A:)
    gshmsetdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflk
    faqalpahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldls
    nlpapfyvllpesfaaritllvqdkalpyvrvsmeywhaleykgelndpaankarkeael
    aaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mw5A (A:)
    etdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqal
    pahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpap
    fyvllpesfaaritllvqdkalpyvrvsmeywhaleykgeln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mw5B (B:)
    gshmsetdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflk
    faqalpahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldls
    nlpapfyvllpesfaaritllvqdkalpyvrvsmeywhaleykgelndpaankarkeael
    aaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mw5B (B:)
    etdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqal
    pahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpap
    fyvllpesfaaritllvqdkalpyvrvsmeywhaleykgeln