PDB entry 1mw4

View 1mw4 on RCSB PDB site
Description: Solution structure of the human Grb7-SH2 domain in complex with a 10 amino acid peptide pY1139
Class: hormone/growth factor/transferase
Keywords: SH2 domain in complex with a ligand, HORMONE-GROWTH FACTOR-TRANSFERASE COMPLEX
Deposited on 2002-09-27, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14451 (2-119)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1mw4a1, d1mw4a2
  • Chain 'B':
    Compound: Receptor protein-tyrosine kinase erbB-2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04626 (0-9)
      • modified residue (4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mw4A (A:)
    gspasgtslsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslc
    hlqkvkhylilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval
    

  • Chain 'B':
    No sequence available.