PDB entry 1mvz

View 1mvz on RCSB PDB site
Description: NMR solution structure of a Bowman Birk inhibitor isolated from snail medic seeds (Medicago Scutellata)
Class: hydrolase inhibitor
Keywords: Serine protease inhibitor, three stranded beta-sheet, VIb type turn, hydrolase inhibitor
Deposited on 2002-09-27, released 2003-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bowman-Birk type protease inhibitor, (MSTI)
    Species: Medicago scutellata [TaxId:36901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80321 (0-61)
      • see remark 999 (41)
      • see remark 999 (43)
      • see remark 999 (48)
      • see remark 999 (61)
    Domains in SCOPe 2.07: d1mvza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mvzA (A:)
    tkstttaccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps
    cs