PDB entry 1mvy

View 1mvy on RCSB PDB site
Description: Amylosucrase mutant E328Q co-crystallized with maltoheptaose.
Class: transferase
Keywords: (beta-alpha)8 barrel, protein-sugar complex, TRANSFERASE
Deposited on 2002-09-27, released 2002-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Database cross-references and differences (RAF-indexed):
    • GB CAA09772 (4-627)
      • cloning artifact (0-3)
      • see remark 999 (130)
      • engineered (327)
    Domains in SCOPe 2.08: d1mvya1, d1mvya2, d1mvya3
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mvyA (A:)
    spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
    lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
    yfqelgltylylmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
    vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
    edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce
    nlpqahalirafnavmriaapavffksqaivhpdqvvqyigqdecqigynplqmallwnt
    latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
    ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
    lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqglrh
    miavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfka
    hdliggktvslnqdltlqpyqvmwleia