PDB entry 1mvu

View 1mvu on RCSB PDB site
Description: single chain fv of c219 heavy chain v101l mutant in complex with synthetic epitope peptide
Class: immune system
Keywords: SINGLE CHAIN FV, MONOCLONAL ANTIBODY, C219, P-GLYCOPROTEIN, IMMUNOGLOBULIN, SITE-DIRECTED MUTAGENESIS, immune system
Deposited on 2002-09-26, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.197
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig kappa-chain VJ-region (Light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • gb aaa38730 (0-End)
      • conflict (111)
    Domains in SCOPe 2.07: d1mvua_
  • Chain 'B':
    Compound: Ig VDJ-region (HEAVY CHAIN)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MVU (0-120)
    Domains in SCOPe 2.07: d1mvub_
  • Chain 'P':
    Compound: p-glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • gb AAA37004 (0-12)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mvuA (A:)
    divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklepkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvuA (A:)
    divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mvuB (B:)
    evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
    apkfqdkatiiadtssntaylqlssltsedtavyycarrelysyyspldvwgagttvtvp
    s
    

  • Chain 'P':
    No sequence available.