PDB entry 1mvr

View 1mvr on RCSB PDB site
Description: Decoding Center & Peptidyl transferase center from the X-ray structure of the Thermus thermophilus 70S ribosome, aligned to the low resolution Cryo-EM map of E.coli 70S Ribosome
Class: ribosome
Keywords: RF2, Release Complex, Conformational Changes, RIBOSOME
Deposited on 2002-09-26, released 2003-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: EM
Resolution: 12.8 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: mRNA, triplet codon (A-site)
    Species: Escherichia coli [TaxId:83333]
  • Chain 'A':
    Compound: Helix 34 of 16S rRNA
    Species: Escherichia coli [TaxId:83333]
  • Chain 'B':
    Compound: Helix 44 of 16S rRNA
    Species: Escherichia coli [TaxId:83333]
  • Chain 'C':
    Compound: helix 69 of 23S rRNA
    Species: Escherichia coli [TaxId:83333]
  • Chain 'D':
    Compound: Helix 89 of 23S rRNA
    Species: Escherichia coli [TaxId:83333]
  • Chain 'E':
    Compound: Helix 93 of 23S rRNA
    Species: Escherichia coli [TaxId:83333]
  • Chain 'L':
    Compound: 50S ribosomal protein L11
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mvrl_
  • Chain 'O':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mvro_

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >1mvrL (L:)
akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
edksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansl
eaamkiiegtaksmgievvd

    Sequence, based on observed residues (ATOM records): (download) 
    >1mvrL (L:)
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

  • Chain 'O':
    Sequence, based on SEQRES records: (download) 
    >1mvrO (O:)
mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
gtkkpkeaaktaakk

    Sequence, based on observed residues (ATOM records): (download) 
    >1mvrO (O:)
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea