PDB entry 1mvq

View 1mvq on RCSB PDB site
Description: Cratylia mollis lectin (isoform 1) in complex with methyl-alpha-D-mannose
Class: sugar binding protein
Keywords: legume lectin, SUGAR BINDING PROTEIN
Deposited on 2002-09-26, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.142
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin, isoform 1
    Species: Cratylia mollis [TaxId:252530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mvqa_
  • Heterogens: MMA, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mvqA (A:)
adtivaveldtypntdigdpsyqhiginiksirskattrwdvqngkvgtahisynsvakr
lsavvsypggssatvsydvdlnnilpewvrvglsastglyketntilswsftsklksnst
adaqslhftfnqfsqspkdlilqgdastdsdgnlqltrvsngspqsdsvgralyyapvhi
wdksavvasfdatftflikspdreiadgiaffiantdssiphgsggrllglfpdan