PDB entry 1mvq

View 1mvq on RCSB PDB site
Description: Cratylia mollis lectin (isoform 1) in complex with methyl-alpha-D-mannose
Deposited on 2002-09-26, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.142
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mvqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mvqA (A:)
    adtivaveldtypntdigdpsyqhiginiksirskattrwdvqngkvgtahisynsvakr
    lsavvsypggssatvsydvdlnnilpewvrvglsastglyketntilswsftsklksnst
    adaqslhftfnqfsqspkdlilqgdastdsdgnlqltrvsngspqsdsvgralyyapvhi
    wdksavvasfdatftflikspdreiadgiaffiantdssiphgsggrllglfpdan