PDB entry 1mvp

View 1mvp on RCSB PDB site
Description: structural studies of the retroviral proteinase from avian myeloblastosis associated virus
Deposited on 1990-09-07, released 1992-01-15
The last revision prior to the SCOP 1.61 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1mvpa_
  • Chain 'B':
    Domains in SCOP 1.61: d1mvpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mvpA (A:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeaa
    npqihgigggipmrksrdmievgvinrdgslerplllfpavamvrgsilgrdclqglglr
    ltnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvpA (A:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeap
    mrksrdmievgvinrdgslerplllfpavamvrgsilgrdclqglglrltnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mvpB (B:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeaa
    npqihgigggipmrksrdmievgvinrdgslerplllfpavamvrgsilgrdclqglglr
    ltnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvpB (B:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmepm
    rksrdmievgvinrdgslerplllfpavamvrgsilgrdclqglglrltnl